Recombinant Human SLC9A3

• Cat.No.: SLC9A3-31431TH
• Product Overview: Recombinant fragment corresponding to amino acids 670-779 of Human Sodium / Hydrogen Exchanger 3 with an N terminal proprietary tag; Predicted MWt 37.84 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• ProteinLength: 110 amino acids
• Molecular Weight: 37.840kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: GLNQNKKAAKLYKRERAQKRRNSSIPNGKLPMESPAQNFT IKEKDLELSDTEEPPNYDEEMSGGIEFLASVTKDTASDSP AGIDNPVFSPDEALDRSLLARLPPWLSPGE
• Sequence Similarities: Belongs to the monovalent cation:proton antiporter 1 (CPA1) transporter (TC 2.A.36) family.

Gene Information

• Gene Name: SLC9A3 solute carrier family 9 (sodium/hydrogen exchanger), member 3 [ Homo sapiens ]
• Official Symbol: SLC9A3
• Synonyms: SLC9A3; solute carrier family 9 (sodium/hydrogen exchanger), member 3; NHE3, solute carrier family 9 (sodium/hydrogen exchanger), isoform 3; sodium/hydrogen exchanger 3
• Gene ID: 6550
• mRNA Refseq: NM_004174
• Protein Refseq: NP_004165
• MIM: 182307
• Uniprot ID: P48764
• Chromosome Location: 5p15.3
• Pathway: Bile secretion, organism-specific biosystem; Bile secretion, conserved biosystem; Endothelins, organism-specific biosystem; Mineral absorption, organism-specific biosystem; Mineral absorption, conserved biosystem
• Function: antiporter activity; sodium:hydrogen antiporter activity; solute:hydrogen antiporter activity