Recombinant Human SLC7A1

• Cat.No.: SLC7A1-26816TH
• Product Overview: Recombinant fragment of Human CAT1 with an N terminal proprietary tag. Predicted MW 32.45kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 62 amino acids
• Description: High affinity cationic amino acid transporter 1 is a protein that in humans is encoded by the SLC7A1 gene.
• Molecular Weight: 32.450kDa inclusive of tags
• Tissue specificity: Ubiquitous.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: RYQPEQPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKIS
• Sequence Similarities: Belongs to the amino acid-polyamine-organocation (APC) superfamily. Cationic amino acid transporter (CAT) (TC 2.A.3.3) family.

Gene Information

• Gene Name: SLC7A1 solute carrier family 7 (cationic amino acid transporter, y+ system), member 1 [ Homo sapiens ]
• Official Symbol: SLC7A1
• Synonyms: SLC7A1; solute carrier family 7 (cationic amino acid transporter, y+ system), member 1; ATRC1, ERR; high affinity cationic amino acid transporter 1; amino acid transporter; cationic 1; CAT 1; ecotropic retroviral receptor; HCAT1; REC1L
• Gene ID: 6541
• mRNA Refseq: NM_003045
• Protein Refseq: NP_003036
• MIM: 104615
• Uniprot ID: P30825
• Chromosome Location: 13q12-q14
• Pathway: Amino acid transport across the plasma membrane, organism-specific biosystem; SLC-mediated transmembrane transport, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; Transport of inorganic cations/anions and amino acids/oligopeptides, organism-specific biosystem
• Function: amino acid transmembrane transporter activity; arginine transmembrane transporter activity; receptor activity