Recombinant Human SLC6A9 Protein, GST-tagged

• Cat.No.: SLC6A9-26H
• Product Overview: Recombinant Human SLC6A9 Protein(209-285 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 209-285 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: SSMTHVLPWAYCNNPWNTHDCAGVLDASNLTNGSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGE
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: SLC6A9
• Synonyms: SLC6A9; solute carrier family 6 (neurotransmitter transporter, glycine), member 9; sodium- and chloride-dependent glycine transporter 1; GLYT1; glyT-1; solute carrier family 6 member 9; DKFZp547A1118
• Gene ID: 6536
• mRNA Refseq: NM_001024845
• Protein Refseq: NP_001020016
• MIM: 601019
• UniProt ID: P48067