Recombinant Human SLC5A11 protein, His-tagged

• Cat.No.: SLC5A11-3429H
• Product Overview: Recombinant Human SLC5A11 protein(476-589 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 476-589 aa
• AA Sequence: SWFTEPPSKEMVSHLTWFTRHDPVVQKEQAPPAAPLSLTLSQNGMPEASSSSSVQFEMVQENTSKTHSCDMTPKQSKVVKAILWLCGIQEKGKEELPARAEAIIVSLEENPLVK
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: SLC5A11 solute carrier family 5 (sodium/glucose cotransporter), member 11 [ Homo sapiens ]
• Official Symbol: SLC5A11
• Synonyms: SLC5A11; solute carrier family 5 (sodium/glucose cotransporter), member 11; sodium/myo-inositol cotransporter 2; KST1; SGLT6; SMIT2; homolog of rabbit KST1; na+/myo-inositol cotransporter 2; sodium/glucose cotransporter KST1; sodium/myo-inositol transporter 2; solute carrier family 5 member 11; Na(+)/myo-inositol cotransporter 2; sodium-dependent glucose cotransporter; putative sodium-coupled cotransporter RKST1; RKST1
• Gene ID: 115584
• mRNA Refseq: NM_052944
• Protein Refseq: NP_443176
• MIM: 610238
• UniProt ID: Q8WWX8