Recombinant Human SLC5A11 protein, His-tagged

Cat.No. : SLC5A11-3429H
Product Overview : Recombinant Human SLC5A11 protein(476-589 aa), fused to His tag, was expressed in E. coli.
Availability April 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 476-589 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : SWFTEPPSKEMVSHLTWFTRHDPVVQKEQAPPAAPLSLTLSQNGMPEASSSSSVQFEMVQENTSKTHSCDMTPKQSKVVKAILWLCGIQEKGKEELPARAEAIIVSLEENPLVK
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name SLC5A11 solute carrier family 5 (sodium/glucose cotransporter), member 11 [ Homo sapiens ]
Official Symbol SLC5A11
Synonyms SLC5A11; solute carrier family 5 (sodium/glucose cotransporter), member 11; sodium/myo-inositol cotransporter 2; KST1; SGLT6; SMIT2; homolog of rabbit KST1; na+/myo-inositol cotransporter 2; sodium/glucose cotransporter KST1; sodium/myo-inositol transporter 2; solute carrier family 5 member 11; Na(+)/myo-inositol cotransporter 2; sodium-dependent glucose cotransporter; putative sodium-coupled cotransporter RKST1; RKST1;
Gene ID 115584
mRNA Refseq NM_052944
Protein Refseq NP_443176
MIM 610238
UniProt ID Q8WWX8

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SLC5A11 Products

Required fields are marked with *

My Review for All SLC5A11 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon