Recombinant Human SLC4A1 protein, His&Myc-tagged

Cat.No. : SLC4A1-3501H
Product Overview : Recombinant Human SLC4A1 protein(P02730)(1-403aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc
Protein Length : 1-403aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 50.3 kDa
AA Sequence : MEELQDDYEDMMEENLEQEEYEDPDIPESQMEEPAAHDTEATATDYHTTSHPGTHKVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSSPAKPDSSFYKGLDLNGGPDDPLQQTGQLFGGLVRDIRRRYPYYLSDITDAFSP
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name SLC4A1 solute carrier family 4, anion exchanger, member 1 (erythrocyte membrane protein band 3, Diego blood group) [ Homo sapiens ]
Official Symbol SLC4A1
Synonyms SLC4A1; solute carrier family 4, anion exchanger, member 1 (erythrocyte membrane protein band 3, Diego blood group); AE1, DI, EPB3, Waldner blood group , WD; band 3 anion transport protein; CD233; FR; Froese blood group; RTA1A; SW; Swann blood group; WR; Wright blood group; anion exchanger 1; anion exchanger-1; Waldner blood group; anion exchange protein 1; erythroid anion exchange protein; erythrocyte membrane protein band 3; solute carrier family 4, anion exchanger, number 1; DI; WD; AE1; WD1; BND3; EPB3; EMPB3; MGC116750; MGC116753; MGC126619; MGC126623;
Gene ID 6521
mRNA Refseq NM_000342
Protein Refseq NP_000333
UniProt ID P02730

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SLC4A1 Products

Required fields are marked with *

My Review for All SLC4A1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon