Recombinant Human SLC44A2 Protein, GST-tagged
Cat.No. : | SLC44A2-2072H |
Product Overview : | Human CTL2 partial ORF ( AAH40556, 123 a.a. - 230 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | SLC44A2 (Solute Carrier Family 44 Member 2) is a Protein Coding gene. Diseases associated with SLC44A2 include Choline Deficiency Disease and Deafness, Autosomal Recessive 68. Among its related pathways are Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds and Innate Immune System. GO annotations related to this gene include signal transducer activity and choline transmembrane transporter activity. An important paralog of this gene is SLC44A5. |
Molecular Mass : | 37.62 kDa |
AA Sequence : | YLNARSSRDFEYYKQFCVPGFKNNKGVAEVLRDGDCPAVLIPSKPLARRCFPAIHAYKGVLMVGNETTYEDGHGSRKNITDLVEGAKKANGVLEARQLAMRIFEDYTV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | SLC44A2 solute carrier family 44, member 2 [ Homo sapiens ] |
Official Symbol | SLC44A2 |
Synonyms | SLC44A2; solute carrier family 44, member 2; choline transporter-like protein 2; CTL2; PP1292; FLJ44586; DKFZp666A071; |
Gene ID | 57153 |
mRNA Refseq | NM_001145056 |
Protein Refseq | NP_001138528 |
MIM | 606106 |
UniProt ID | Q8IWA5 |
◆ Recombinant Proteins | ||
SLC44A2-2772H | Recombinant Human SLC44A2, His-tagged | +Inquiry |
SLC44A2-5541R | Recombinant Rat SLC44A2 Protein | +Inquiry |
SLC44A2-5200R | Recombinant Rat SLC44A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC44A2-866H | Recombinant Human SLC44A2 Protein, His-tagged | +Inquiry |
SLC44A2-8378M | Recombinant Mouse SLC44A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC44A2-1712HCL | Recombinant Human SLC44A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC44A2 Products
Required fields are marked with *
My Review for All SLC44A2 Products
Required fields are marked with *
0
Inquiry Basket