Recombinant Human SLC44A2 Protein, GST-tagged

• Cat.No.: SLC44A2-2072H
• Product Overview: Human CTL2 partial ORF ( AAH40556, 123 a.a. - 230 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: SLC44A2 (Solute Carrier Family 44 Member 2) is a Protein Coding gene. Diseases associated with SLC44A2 include Choline Deficiency Disease and Deafness, Autosomal Recessive 68. Among its related pathways are Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds and Innate Immune System. GO annotations related to this gene include signal transducer activity and choline transmembrane transporter activity. An important paralog of this gene is SLC44A5.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 37.62 kDa
• AA Sequence: YLNARSSRDFEYYKQFCVPGFKNNKGVAEVLRDGDCPAVLIPSKPLARRCFPAIHAYKGVLMVGNETTYEDGHGSRKNITDLVEGAKKANGVLEARQLAMRIFEDYTV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SLC44A2 solute carrier family 44, member 2 [ Homo sapiens ]
• Official Symbol: SLC44A2
• Synonyms: SLC44A2; solute carrier family 44, member 2; choline transporter-like protein 2; CTL2; PP1292; FLJ44586; DKFZp666A071
• Gene ID: 57153
• mRNA Refseq: NM_001145056
• Protein Refseq: NP_001138528
• MIM: 606106
• UniProt ID: Q8IWA5