Recombinant Human SLC43A2 protein, His-tagged

Cat.No. : SLC43A2-552H
Product Overview : Recombinant Human SLC43A2 protein(Q8N370)(224-322aa), fused with N-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 224-322aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 15.2 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : NCFFNWPLEPFPGPEDMDYSVKIKFSWLGFDHKITGKQFYKQVTTVGRRLSVGSSMRSAKEQVALQEGHKLCLSTVDLEVKCQPDAAVAPSFMHSVFSP
Gene Name SLC43A2 solute carrier family 43, member 2 [ Homo sapiens ]
Official Symbol SLC43A2
Synonyms SLC43A2; solute carrier family 43, member 2; large neutral amino acids transporter small subunit 4; MGC34680; amino acid transporter; L-type amino acid transporter 4; LAT4; FLJ23848;
Gene ID 124935
mRNA Refseq NM_152346
Protein Refseq NP_689559
MIM 610791
UniProt ID Q8N370

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SLC43A2 Products

Required fields are marked with *

My Review for All SLC43A2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon