Recombinant Human SLC43A2 protein, His-tagged
Cat.No. : | SLC43A2-552H |
Product Overview : | Recombinant Human SLC43A2 protein(Q8N370)(224-322aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 224-322aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 15.2 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | NCFFNWPLEPFPGPEDMDYSVKIKFSWLGFDHKITGKQFYKQVTTVGRRLSVGSSMRSAKEQVALQEGHKLCLSTVDLEVKCQPDAAVAPSFMHSVFSP |
Gene Name | SLC43A2 solute carrier family 43, member 2 [ Homo sapiens ] |
Official Symbol | SLC43A2 |
Synonyms | SLC43A2; solute carrier family 43, member 2; large neutral amino acids transporter small subunit 4; MGC34680; amino acid transporter; L-type amino acid transporter 4; LAT4; FLJ23848; |
Gene ID | 124935 |
mRNA Refseq | NM_152346 |
Protein Refseq | NP_689559 |
MIM | 610791 |
UniProt ID | Q8N370 |
◆ Recombinant Proteins | ||
SLC43A2-4295R | Recombinant Rhesus monkey SLC43A2 Protein, His-tagged | +Inquiry |
SLC43A2-4111R | Recombinant Rhesus Macaque SLC43A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC43A2-15450M | Recombinant Mouse SLC43A2 Protein | +Inquiry |
SLC43A2-674H | Recombinant Human SLC43A2 Protein, GST-tagged | +Inquiry |
SLC43A2-8376M | Recombinant Mouse SLC43A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC43A2-1713HCL | Recombinant Human SLC43A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC43A2 Products
Required fields are marked with *
My Review for All SLC43A2 Products
Required fields are marked with *
0
Inquiry Basket