Recombinant Human SLC3A2 protein(271-390 aa), C-His-tagged

• Cat.No.: SLC3A2-2592H
• Product Overview: Recombinant Human SLC3A2 protein(P08195)(271-390 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 271-390 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: DVAQTDLLQIDPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDIENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDLQQILS
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: SLC3A2 solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2 [ Homo sapiens ]
• Official Symbol: SLC3A2
• Synonyms: SLC3A2; solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2; MDU1; 4F2 cell-surface antigen heavy chain; 4F2; 4F2 cell surface antigen heavy chain; 4F2 heavy chain; 4F2HC; 4T2HC; antigen defined by monoclonal 4F2; antigen identified by monoclonal antibodies 4F2; TRA1.10; TROP4; and T43; CD98; CD98 heavy chain; CD98HC; heavy chain; lymphocyte activation antigen 4F2 large subunit; monoclonal 44D7; NACAE; antigen defined by monoclonal 4F2, heavy chain; antigen identified by monoclonal antibodies 4F2, TRA1.10, TROP4, and T43
• Gene ID: 6520
• mRNA Refseq: NM_001012662
• Protein Refseq: NP_001012680
• MIM: 158070
• UniProt ID: P08195