Recombinant Human SLC39A13 protein, His-tagged

• Cat.No.: SLC39A13-2718H
• Product Overview: Recombinant Human SLC39A13 protein(1-68 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-68 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MPGCPCPGCGMAGPRLLFLTALALELLGRAGGSQPALRSRGTATACRLDNKESESWGALLSGERLDTW
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: SLC39A13 solute carrier family 39 (zinc transporter), member 13 [ Homo sapiens ]
• Official Symbol: SLC39A13
• Synonyms: SLC39A13; solute carrier family 39 (zinc transporter), member 13; solute carrier family 39 (metal ion transporter), member 13; zinc transporter ZIP13; FLJ25785; LZT-Hs9; zrt- and Irt-like protein 13; LIV-1 subfamily of ZIP zinc transporter 9
• Gene ID: 91252
• mRNA Refseq: NM_001128225
• Protein Refseq: NP_001121697
• MIM: 608735
• UniProt ID: Q96H72