Recombinant Human SLC39A11 protein, His-GST-tagged

• Cat.No.: SLC39A11-2708H
• Product Overview: Recombinant Human SLC39A11 protein(Q8N1S5)(93-193aa), fused with N-terminal His and GST tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: N-His-GST
• Protein length: 93-193aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 42.2 kDa
• AASequence: YLADLLMPHLGAAEDPQTTLALNFGSTLMKKKSDPEGPALLFPESELSIRIGRAGLLSDKSENGEAYQRKKAAATGLPEGPAVPVPSRGNLAQPGGSSWRR
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: SLC39A11 solute carrier family 39 (metal ion transporter), member 11 [ Homo sapiens ]
• Official Symbol: SLC39A11
• Synonyms: SLC39A11; solute carrier family 39 (metal ion transporter), member 11; C17orf26, chromosome 17 open reading frame 26; zinc transporter ZIP11; ZIP-11; Zrt- and Irt-like protein 11; solute carrier family 39 member 11; ZIP11; C17orf26
• Gene ID: 201266
• mRNA Refseq: NM_001159770
• Protein Refseq: NP_001153242
• UniProt ID: Q8N1S5