Recombinant Human SLC39A1 Protein (126-179 aa), His-tagged

• Cat.No.: SLC39A1-1304H
• Product Overview: Recombinant Human SLC39A1 Protein (126-179 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Transport. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 126-179 aa
• Description: Mediates zinc uptake. May function as a major endogenous zinc uptake transporter in many cells of the body. Responsible for the rapid uptake and accumulation of physiologically effective zinc in prostate cells.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 9.6 kDa
• AA Sequence: MEQITLAYKEQSGPSPLEETRALLGTVNGGPQHWHDGPGVPQASGAPATPSALR
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: SLC39A1 solute carrier family 39 (zinc transporter), member 1 [ Homo sapiens ]
• Official Symbol: SLC39A1
• Synonyms: SLC39A1; ZIP1; ZIP-1; hZIP1; ZIRTL
• Gene ID: 27173
• mRNA Refseq: NM_014437
• Protein Refseq: NP_055252
• MIM: 604740
• UniProt ID: Q9NY26