Recombinant Human SLC38A5 protein, GST-tagged

• Cat.No.: SLC38A5-301265H
• Product Overview: Recombinant Human SLC38A5 (219-262 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Leu219-Val262
• AA Sequence: LGCAIGHNETAMESEALVGLPSQGLNSSCEAQMFTVDSQMSYTV
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: SLC38A5 solute carrier family 38 member 5 [ Homo sapiens (human) ]
• Official Symbol: SLC38A5
• Synonyms: SN2; JM24; SNAT5; pp7194
• Gene ID: 92745
• mRNA Refseq: NM_033518
• Protein Refseq: NP_277053
• MIM: 300649
• UniProt ID: Q8WUX1