Recombinant Human SLC35C2 protein, GST-tagged

• Cat.No.: SLC35C2-301302H
• Product Overview: Recombinant Human SLC35C2 (306-365 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Cys306-Gln365
• AA Sequence: CLSGISLHVALKALHSRGDGGPKALKGLGSSPDLELLLRSSQREEGDNEEEEYFVAQGQQ
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: SLC35C2 solute carrier family 35, member C2 [ Homo sapiens ]
• Official Symbol: SLC35C2
• Synonyms: SLC35C2; solute carrier family 35, member C2; C20orf5, ovarian cancer overexpressed 1 , OVCOV1; solute carrier family 35 member C2; bA394O2.1; CGI 15; ovarian cancer overexpressed 1; ovarian cancer-overexpressed gene 1 protein; CGI-15; OVCOV1; C20orf5; BA394O2.1; FLJ37039; FLJ46434; MGC20633; MGC32079; MGC39183
• Gene ID: 51006
• mRNA Refseq: NM_015945
• Protein Refseq: NP_057029
• UniProt ID: Q9NQQ7