Recombinant Human SLC35A3 protein, His-tagged

• Cat.No.: SLC35A3-3649H
• Product Overview: Recombinant Human SLC35A3 protein(158-220 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 158-220 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: SDSQLDSKELSAGSQFVGLMAVLTACFSSGFAGVYFEKILKETKQSVWIRNIQLVSFSLEPSL
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: SLC35A3 solute carrier family 35 (UDP-N-acetylglucosamine (UDP-GlcNAc) transporter), member A3 [ Homo sapiens ]
• Official Symbol: SLC35A3
• Synonyms: SLC35A3; solute carrier family 35 (UDP-N-acetylglucosamine (UDP-GlcNAc) transporter), member A3; solute carrier family 35 (UDP N acetylglucosamine (UDP GlcNAc) transporter), member 3; UDP-N-acetylglucosamine transporter; golgi UDP-GlcNAc transporter; solute carrier family 35 member A3; solute carrier family 35 (UDP-N-acetylglucosamine (UDP-GlcNAc) transporter), member 3; DKFZp781P1297
• Gene ID: 23443
• mRNA Refseq: NM_012243
• Protein Refseq: NP_036375
• MIM: 605632
• UniProt ID: Q9Y2D2