Recombinant Human SLC30A7 protein, GST-tagged

• Cat.No.: SLC30A7-301453H
• Product Overview: Recombinant Human SLC30A7 (287-376 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Arg287-Met376
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: RESVGILMQRTPPLLENSLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLIVAPDADARWILSQTHNIFTQAGVRQLYVQIDFAAM
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: SLC30A7 solute carrier family 30 (zinc transporter), member 7 [ Homo sapiens ]
• Official Symbol: SLC30A7
• Synonyms: SLC30A7; solute carrier family 30 (zinc transporter), member 7; zinc transporter 7; ZNT7; ZnTL2; zinc transporter ZnT-7; znt-like transporter 2; zinc transporter like 2; solute carrier family 30 member 7; ZnT-7; DKFZp686M0368
• Gene ID: 148867
• mRNA Refseq: NM_001144884
• Protein Refseq: NP_001138356
• MIM: 611149
• UniProt ID: Q8NEW0