Recombinant Human SLC2A9 protein, His-tagged

Source :	E. coli
Species :	Human
Tag :	His
Form :	The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
Protein length :	443-511 aa
AA Sequence :	IQKSLDTYCFLVFATICITGAIYLYFVLPETKNRTYAEISQAFSKRNKAYPPEEKIDSAVTDGKINGRP
Purity :	95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage :	Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution :	Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Name	SLC2A9 solute carrier family 2 (facilitated glucose transporter), member 9 [ Homo sapiens ]
Official Symbol	SLC2A9
Synonyms	SLC2A9; solute carrier family 2 (facilitated glucose transporter), member 9; solute carrier family 2, facilitated glucose transporter member 9; Glut9; GLUTX; urate voltage driven efflux transporter 1; URATv1; GLUT-9; glucose transporter type 9; human glucose transporter-like protein-9; urate voltage-driven efflux transporter 1; GLUT9; UAQTL2;
Gene ID	56606
mRNA Refseq	NM_001001290
Protein Refseq	NP_001001290
MIM	606142
UniProt ID	Q9NRM0