Recombinant Human SLC2A9 protein, His-tagged

• Cat.No.: SLC2A9-2547H
• Product Overview: Recombinant Human SLC2A9 protein(443-511 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 443-511 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: IQKSLDTYCFLVFATICITGAIYLYFVLPETKNRTYAEISQAFSKRNKAYPPEEKIDSAVTDGKINGRP
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: SLC2A9 solute carrier family 2 (facilitated glucose transporter), member 9 [ Homo sapiens ]
• Official Symbol: SLC2A9
• Synonyms: SLC2A9; solute carrier family 2 (facilitated glucose transporter), member 9; solute carrier family 2, facilitated glucose transporter member 9; Glut9; GLUTX; urate voltage driven efflux transporter 1; URATv1; GLUT-9; glucose transporter type 9; human glucose transporter-like protein-9; urate voltage-driven efflux transporter 1; GLUT9; UAQTL2
• Gene ID: 56606
• mRNA Refseq: NM_001001290
• Protein Refseq: NP_001001290
• MIM: 606142
• UniProt ID: Q9NRM0