Recombinant Human SLC2A2

Cat.No. : SLC2A2-28420TH
Product Overview : Recombinant fragment corresponding to amino acids 32-98 of Human Glucose Transporter GLUT2 with proprietary tag; Predicted MWt 33 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 67 amino acids
Description : Glucose transporter 2 isoform is an integral plasma membrane glycoprotein of the liver, islet beta cells, intestine, and kidney epithelium. It mediates facilitated bidirectional glucose transport. Because of its low affinity for glucose, it has been suggested as a glucose sensor.
Molecular Weight : 33.000kDa inclusive of tags
Tissue specificity : Liver, insulin-producing beta cell, small intestine and kidney.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : NAPQQVIISHYRHVLGVPLDDRKAINNYVINSTDELPTISYSMNPKPTPWAEEETVAAAQLITMLWS
Sequence Similarities : Belongs to the major facilitator superfamily. Sugar transporter (TC 2.A.1.1) family. Glucose transporter subfamily.
Gene Name SLC2A2 solute carrier family 2 (facilitated glucose transporter), member 2 [ Homo sapiens ]
Official Symbol SLC2A2
Synonyms SLC2A2; solute carrier family 2 (facilitated glucose transporter), member 2; GLUT2; solute carrier family 2, facilitated glucose transporter member 2;
Gene ID 6514
mRNA Refseq NM_000340
Protein Refseq NP_000331
MIM 138160
Uniprot ID P11168
Chromosome Location 3q26.2-q27
Pathway Carbohydrate digestion and absorption, organism-specific biosystem; Carbohydrate digestion and absorption, conserved biosystem; Developmental Biology, organism-specific biosystem; FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; Facilitative Na+-independent glucose transporters, organism-specific biosystem;
Function D-glucose transmembrane transporter activity; dehydroascorbic acid transporter activity; glucose transmembrane transporter activity; hexose transmembrane transporter activity; insulin receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SLC2A2 Products

Required fields are marked with *

My Review for All SLC2A2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon