Recombinant Human SLC25A19 Full Length Transmembrane protein, His-tagged

Cat.No. : SLC25A19-1006H
Product Overview : Recombinant Human SLC25A19 protein(Q9HC21)(1-320aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-320aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 37.0 kDa
AA Sequence : MVGYDPKPDGRNNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYHGILQASRQILQEEGPTAFWKGHVPAQILSIGYGAVQFLSFEMLTELVHRGSVYDAREFSVHFVCGGLAACMATLTVHPVDVLRTRFAAQGEPKVYNTLRHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAIPAEGKKNENLQNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKGLSPSLLKAALSTGFMFFSYEFFCNVFHCMNRTASQR
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name SLC25A19 solute carrier family 25 (mitochondrial thiamine pyrophosphate carrier), member 19 [ Homo sapiens ]
Official Symbol SLC25A19
Synonyms SLC25A19; solute carrier family 25 (mitochondrial thiamine pyrophosphate carrier), member 19; MCPHA, microcephaly, Amish , solute carrier family 25 (mitochondrial deoxynucleotide carrier), member 19; mitochondrial thiamine pyrophosphate carrier; DNC; MUP1; TPC; microcephaly, Amish; mitochondrial uncoupling protein 1; solute carrier family 25 (mitochondrial deoxynucleotide carrier), member 19; MCPHA; THMD3; THMD4;
Gene ID 60386
mRNA Refseq NM_001126121
Protein Refseq NP_001119593
MIM 606521
UniProt ID Q9HC21

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SLC25A19 Products

Required fields are marked with *

My Review for All SLC25A19 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon