Recombinant Human SLC25A19 Full Length Transmembrane protein, His-tagged
| Cat.No. : | SLC25A19-1006H |
| Product Overview : | Recombinant Human SLC25A19 protein(Q9HC21)(1-320aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
| Source : | In vitro E. coli expression system |
| Species : | Human |
| Tag : | His |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 37.0 kDa |
| Protein length : | 1-320aa |
| AA Sequence : | MVGYDPKPDGRNNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYHGILQASRQILQEEGPTAFWKGHVPAQILSIGYGAVQFLSFEMLTELVHRGSVYDAREFSVHFVCGGLAACMATLTVHPVDVLRTRFAAQGEPKVYNTLRHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAIPAEGKKNENLQNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKGLSPSLLKAALSTGFMFFSYEFFCNVFHCMNRTASQR |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | SLC25A19 solute carrier family 25 (mitochondrial thiamine pyrophosphate carrier), member 19 [ Homo sapiens ] |
| Official Symbol | SLC25A19 |
| Synonyms | SLC25A19; solute carrier family 25 (mitochondrial thiamine pyrophosphate carrier), member 19; MCPHA, microcephaly, Amish , solute carrier family 25 (mitochondrial deoxynucleotide carrier), member 19; mitochondrial thiamine pyrophosphate carrier; DNC; MUP1; TPC; microcephaly, Amish; mitochondrial uncoupling protein 1; solute carrier family 25 (mitochondrial deoxynucleotide carrier), member 19; MCPHA; THMD3; THMD4; |
| Gene ID | 60386 |
| mRNA Refseq | NM_001126121 |
| Protein Refseq | NP_001119593 |
| MIM | 606521 |
| UniProt ID | Q9HC21 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC25A19 Products
Required fields are marked with *
My Review for All SLC25A19 Products
Required fields are marked with *
0
Inquiry Basket
