Recombinant Human SLC22A3
Cat.No. : | SLC22A3-31412TH |
Product Overview : | Recombinant fragment of Human SLC22A3 with N terminal proprietary tag; Predicted MW 32.89 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 66 amino acids |
Description : | Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein. |
Molecular Weight : | 32.890kDa inclusive of tags |
Tissue specificity : | Expressed in placenta, skeletal muscle, prostate, aorta, liver, fetal lung, salivary gland, adrenal gland, kidney and brain cortex. No expression detected in spleen. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | CQRYLLEAANDSASATSALSCADPLAAFPNRSAPLVPCRGGWRYAQAHSTIVSEFDLVCVNAWMLD |
Sequence Similarities : | Belongs to the major facilitator superfamily. Organic cation transporter family. |
Gene Name | SLC22A3 solute carrier family 22 (extraneuronal monoamine transporter), member 3 [ Homo sapiens ] |
Official Symbol | SLC22A3 |
Synonyms | SLC22A3; solute carrier family 22 (extraneuronal monoamine transporter), member 3; solute carrier family 22 member 3; EMT; OCT3; |
Gene ID | 6581 |
mRNA Refseq | NM_021977 |
Protein Refseq | NP_068812 |
MIM | 604842 |
Uniprot ID | O75751 |
Chromosome Location | 6q25.3 |
Pathway | Organic cation transport, organism-specific biosystem; Organic cation/anion/zwitterion transport, organism-specific biosystem; SLC-mediated transmembrane transport, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds, organism-specific biosystem; |
Function | dopamine transmembrane transporter activity; ion transmembrane transporter activity; organic cation transmembrane transporter activity; protein binding; quaternary ammonium group transmembrane transporter activity; |
◆ Recombinant Proteins | ||
SLC22A3-5457R | Recombinant Rat SLC22A3 Protein | +Inquiry |
RFL23216RF | Recombinant Full Length Rat Solute Carrier Family 22 Member 3(Slc22A3) Protein, His-Tagged | +Inquiry |
SLC22A3-31412TH | Recombinant Human SLC22A3 | +Inquiry |
SLC22A3-5116R | Recombinant Rat SLC22A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL12585HF | Recombinant Full Length Human Solute Carrier Family 22 Member 3(Slc22A3) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC22A3 Products
Required fields are marked with *
My Review for All SLC22A3 Products
Required fields are marked with *
0
Inquiry Basket