Recombinant Human SLC1A6 protein, GST-tagged

• Cat.No.: SLC1A6-3497H
• Product Overview: Recombinant Human SLC1A6 protein(P48664)(149-271aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 149-271aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 40.4 kDa
• AA Sequence: MVTIIHPGKGSKEGLHREGRIETIPTADAFMDLIRNMFPPNLVEACFKQFKTQYSTRVVTRTMVRTENGSEPGASMPPPFSVENGTSFLENVTRALGTLQEMLSFEETVPVPGSANGINALGL
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: SLC1A6 solute carrier family 1 (high affinity aspartate/glutamate transporter), member 6 [ Homo sapiens ]
• Official Symbol: SLC1A6
• Synonyms: SLC1A6; solute carrier family 1 (high affinity aspartate/glutamate transporter), member 6; excitatory amino acid transporter 4; EAAT4; solute carrier family 1 member 6; sodium-dependent glutamate/aspartate transporter; MGC33092; MGC43671
• Gene ID: 6511
• mRNA Refseq: NM_005071
• Protein Refseq: NP_005062
• MIM: 600637
• UniProt ID: P48664