Recombinant Human SLC1A4 protein, GST-tagged

Cat.No. : SLC1A4-3761H
Product Overview : Recombinant Human SLC1A4 protein(431-532 aa), fused to GST tag, was expressed in E. coli.
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E. coli
Species : Human
Tag : GST
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
Protein length : 431-532 aa
AA Sequence : IAIILEAIGLPTHDLPLILAVDWIVDRTTTVVNVEGDALGAGILHHLNQKATKKGEQELAEVKVEAIPNCKSEEETSPLVTHQNPAGPVASAPELESKESVL
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name SLC1A4 solute carrier family 1 (glutamate/neutral amino acid transporter), member 4 [ Homo sapiens ]
Official Symbol SLC1A4
Synonyms SLC1A4; solute carrier family 1 (glutamate/neutral amino acid transporter), member 4; neutral amino acid transporter A; alanine/serine/cysteine/threonine transporter; ASCT1; SATT; ASCT-1; solute carrier family 1 member 4; glutamate/neutral amino acid transporter; alanine/serine/cysteine/threonine transporter 1;
Gene ID 6509
mRNA Refseq NM_001193493
Protein Refseq NP_001180422
MIM 600229
UniProt ID P43007

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SLC1A4 Products

Required fields are marked with *

My Review for All SLC1A4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon