Recombinant Human SLC19A2 protein, His&Myc-tagged

• Cat.No.: SLC19A2-4546H
• Product Overview: Recombinant Human SLC19A2 protein(O60779)(215-293aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 215-293aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 16.5 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: LFFHHIPSTCQRVNGIKVQNGGIVTDTPASNHLPGWEDIESKIPLNMEEPPVEEPEPKPDRLLVLKVLWNDFLMCYSSR

Gene Information

• Gene Name: SLC19A2 solute carrier family 19 (thiamine transporter), member 2 [ Homo sapiens ]
• Official Symbol: SLC19A2
• Synonyms: SLC19A2; solute carrier family 19 (thiamine transporter), member 2; TRMA; thiamine transporter 1; THTR1; thTr-1; solute carrier family 19 member 2; high affinity thiamine transporter; reduced folate carrier protein (RFC) like; TC1; THT1; THMD1
• Gene ID: 10560
• mRNA Refseq: NM_006996
• Protein Refseq: NP_008927
• MIM: 603941
• UniProt ID: O60779