Recombinant Human SLC19A2 protein, His&Myc-tagged

Cat.No. : SLC19A2-4546H
Product Overview : Recombinant Human SLC19A2 protein(O60779)(215-293aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc
Protein Length : 215-293aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 16.5 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : LFFHHIPSTCQRVNGIKVQNGGIVTDTPASNHLPGWEDIESKIPLNMEEPPVEEPEPKPDRLLVLKVLWNDFLMCYSSR
Gene Name SLC19A2 solute carrier family 19 (thiamine transporter), member 2 [ Homo sapiens ]
Official Symbol SLC19A2
Synonyms SLC19A2; solute carrier family 19 (thiamine transporter), member 2; TRMA; thiamine transporter 1; THTR1; thTr-1; solute carrier family 19 member 2; high affinity thiamine transporter; reduced folate carrier protein (RFC) like; TC1; THT1; THMD1;
Gene ID 10560
mRNA Refseq NM_006996
Protein Refseq NP_008927
MIM 603941
UniProt ID O60779

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SLC19A2 Products

Required fields are marked with *

My Review for All SLC19A2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon