Recombinant Human SLC18A2

Cat.No. : SLC18A2-29830TH
Product Overview : Recombinant fragment corresponding to amino acids 53-151 of Human VMAT2 with proprietary tag; Predicted MWt 36.52 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 99 amino acids
Description : The vesicular monoamine transporter acts to accumulate cytosolic monoamines into synaptic vesicles, using the proton gradient maintained across the synaptic vesicular membrane. Its proper function is essential to the correct activity of the monoaminergic systems that have been implicated in several human neuropsychiatric disorders. The transporter is a site of action of important drugs, including reserpine and tetrabenazine (summary by Peter et al.
Molecular Weight : 36.520kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : HEKNATEIQTARPVHTASISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKATVQLITNPFIGL
Sequence Similarities : Belongs to the major facilitator superfamily. Vesicular transporter family.
Gene Name SLC18A2 solute carrier family 18 (vesicular monoamine), member 2 [ Homo sapiens ]
Official Symbol SLC18A2
Synonyms SLC18A2; solute carrier family 18 (vesicular monoamine), member 2; VMAT2; synaptic vesicular amine transporter; SVAT; SVMT;
Gene ID 6571
mRNA Refseq NM_003054
Protein Refseq NP_003045
MIM 193001
Uniprot ID Q05940
Chromosome Location 10q25
Pathway Dopamine Neurotransmitter Release Cycle, organism-specific biosystem; Dopaminergic synapse, organism-specific biosystem; Dopaminergic synapse, conserved biosystem; Na+/Cl- dependent neurotransmitter transporters, organism-specific biosystem; Neuronal System, organism-specific biosystem;
Function drug binding; enzyme binding; heat shock protein binding; monoamine transmembrane transporter activity; serotonin transmembrane transporter activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SLC18A2 Products

Required fields are marked with *

My Review for All SLC18A2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon