Recombinant Human SLC13A3 protein, GST-tagged

• Cat.No.: SLC13A3-301399H
• Product Overview: Recombinant Human SLC13A3 (568-602 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Gln568-Leu602
• AA Sequence: QTIFQLGTFPDWADMYSVNVTALPPTLANDTFRTL
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: SLC13A3 solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3 [ Homo sapiens ]
• Official Symbol: SLC13A3
• Synonyms: SLC13A3; solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3; solute carrier family 13 member 3; NADC3; SDCT2; hNaDC3; naDC-3; Na(+)/dicarboxylate cotransporter 3; sodium-dependent high affinity dicarboxylate transporter 3; sodium-dependent high-affinity dicarboxylate transporter 2
• Gene ID: 64849
• mRNA Refseq: NM_001011554
• Protein Refseq: NP_001011554
• MIM: 606411
• UniProt ID: Q8WWT9