Recombinant Human SLC12A1

Cat.No. : SLC12A1-31410TH
Product Overview : Recombinant fragment of Human SLC12A1 with N-terminal proprietary tag.Mol Wt 35.86 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 93 amino acids
Description : This gene encodes a kidney-specific sodium-potassium-chloride cotransporter that is expressed on the luminal membrane of renal epithelial cells of the thick ascending limb of Henles loop and the macula densa. It plays a key role in concentrating urine and accounts for most of the NaCl resorption. It is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Additional splice variants have been described but their biological validity in humans has not been experimentally proven.
Molecular Weight : 35.860kDa inclusive of tags
Tissue specificity : Kidney specific.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : AKTDASFHAYDSHTNTYYLQTFGHNTMDAVPKIEYYRNTGSISGPKVNRPSLLEIHEQLAKNVAVTPSSADRVANGDGIPGDEQAENKEDDQA
Sequence Similarities : Belongs to the SLC12A transporter family.
Gene Name SLC12A1 solute carrier family 12 (sodium/potassium/chloride transporters), member 1 [ Homo sapiens ]
Official Symbol SLC12A1
Synonyms SLC12A1; solute carrier family 12 (sodium/potassium/chloride transporters), member 1; solute carrier family 12 member 1; NKCC2;
Gene ID 6557
mRNA Refseq NM_000338
Protein Refseq NP_000329
MIM 600839
Uniprot ID Q13621
Chromosome Location 15q15-q21
Pathway Cation-coupled Chloride cotransporters, organism-specific biosystem; SLC-mediated transmembrane transport, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; Transport of inorganic cations/anions and amino acids/oligopeptides, organism-specific biosystem;
Function ion transmembrane transporter activity; sodium:potassium:chloride symporter activity; symporter activity; transporter activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SLC12A1 Products

Required fields are marked with *

My Review for All SLC12A1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon