Recombinant Human SLC10A7 Protein, GST-tagged

• Cat.No.: SLC10A7-4044H
• Product Overview: Human DKFZP566M114 full-length ORF ( AAH63471, 1 a.a. - 159 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: SLC10A7 (Solute Carrier Family 10 Member 7) is a Protein Coding gene. GO annotations related to this gene include symporter activity.
• Molecular Mass: 43.23 kDa
• AA Sequence: MRLLERMRKDWFMVGIVLAIAGAKLEPSIGVNGGPLKPEITVSYIAVATIFFNSGLSLKTEELTSALVHLKLHLFIQIFTLAFFPATIWLFLQLLSITPINEWLLKGLQTVGCMPPPVSSAVILTKAVGGNEAAAIFNSAFGSFLVSKHSLTCLLQLLL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SLC10A7 solute carrier family 10 (sodium/bile acid cotransporter family), member 7 [ Homo sapiens ]
• Official Symbol: SLC10A7
• Synonyms: SLC10A7; solute carrier family 10 (sodium/bile acid cotransporter family), member 7; C4orf13, chromosome 4 open reading frame 13; sodium/bile acid cotransporter 7; DKFZp313H0531; DKFZp566M114; DKFZp779O2438; MGC25043; SBF-domain containing protein; Na(+)/bile acid cotransporter 7; solute carrier family 10 member 7; P7; C4orf13
• Gene ID: 84068
• mRNA Refseq: NM_001029998
• Protein Refseq: NP_001025169
• MIM: 611459
• UniProt ID: Q0GE19