Recombinant Human SKIL
Cat.No. : | SKIL-27724TH |
Product Overview : | Recombinant fragment of Human SnoN with a N terminal proprietary tag: predicted molecular weight 34.21 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 78 amino acids |
Description : | The protein encoded by this gene is a component of the SMAD pathway, which regulates cell growth and differentiation through transforming growth factor-beta (TGFB). In the absence of ligand, the encoded protein binds to the promoter region of TGFB-responsive genes and recruits a nuclear repressor complex. TGFB signaling causes SMAD3 to enter the nucleus and degrade this protein, allowing these genes to be activated. Four transcript variants encoding three different isoforms have been found for this gene. |
Molecular Weight : | 34.210kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLGKCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDK |
Gene Name | SKIL SKI-like oncogene [ Homo sapiens ] |
Official Symbol | SKIL |
Synonyms | SKIL; SKI-like oncogene; ski-like protein; SNO; SnoA; SnoN; |
Gene ID | 6498 |
mRNA Refseq | NM_001145098 |
Protein Refseq | NP_001138570 |
MIM | 165340 |
Uniprot ID | P12757 |
Chromosome Location | 3q26 |
Pathway | Regulation of nuclear SMAD2/3 signaling, organism-specific biosystem; TGF Beta Signaling Pathway, organism-specific biosystem; TGF-beta Receptor Signaling Pathway, organism-specific biosystem; TGF-beta receptor signaling, organism-specific biosystem; |
Function | NOT DNA binding; SMAD binding; chromatin binding; chromatin binding; nucleotide binding; |
◆ Recombinant Proteins | ||
SKIL-6729C | Recombinant Chicken SKIL | +Inquiry |
SKIL-27724TH | Recombinant Human SKIL | +Inquiry |
SKIL-2688H | Recombinant Human SKIL, His-tagged | +Inquiry |
SKIL-478HF | Recombinant Full Length Human SKIL Protein | +Inquiry |
SKIL-27723TH | Recombinant Human SKIL | +Inquiry |
◆ Cell & Tissue Lysates | ||
SKIL-1814HCL | Recombinant Human SKIL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SKIL Products
Required fields are marked with *
My Review for All SKIL Products
Required fields are marked with *
0
Inquiry Basket