Recombinant Human SIVA1 Protein (1-110 aa), His-tagged

Cat.No. : SIVA1-1519H
Product Overview : Recombinant Human SIVA1 Protein (1-110 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of isoform 2.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 1-110 aa
Description : Induces CD27-mediated apoptosis. Inhibits BCL2L1 isoform Bcl-x(L) anti-apoptotic activity. Inhibits activation of NF-kappa-B and promotes T-cell receptor-mediated apoptosis.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 13.8 kDa
AA Sequence : MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFDPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name SIVA1 SIVA1, apoptosis-inducing factor [ Homo sapiens ]
Official Symbol SIVA1
Synonyms SIVA1; CD27BP; SIVA; Siva 1; Siva 2; Siva-1; Siva-2;
Gene ID 10572
mRNA Refseq NM_006427
Protein Refseq NP_006418
MIM 605567
UniProt ID O15304

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SIVA1 Products

Required fields are marked with *

My Review for All SIVA1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon