Recombinant Human SIRPA protein, His&Myc-tagged

• Cat.No.: SIRPA-4554H
• Product Overview: Recombinant Human SIRPA protein(P78324)(1-131aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 1-131aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 21.5 kDa
• AA Sequence: MEEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPGRVLIYNQRQGPFPRVTTVSDTTKRNNMDFSIRIGNITPADAGTYYCIKFRKGSPDDVEFKSGAGTELSVRAKPVDGGFLGGGGCG
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: SIRPA signal-regulatory protein alpha [ Homo sapiens ]
• Official Symbol: SIRPA
• Synonyms: SIRPA; signal-regulatory protein alpha; protein tyrosine phosphatase, non receptor type substrate 1 , PTPNS1; tyrosine-protein phosphatase non-receptor type substrate 1; BIT; CD172a; MFR; MYD 1; P84; SHPS 1; SHPS1; SIRP; SIRP ALPHA 1; SIRPalpha; SIRPalpha2; myd-1 antigen; inhibitory receptor SHPS-1; macrophage fusion receptor; CD172 antigen-like family member A; tyrosine phosphatase SHP substrate 1; brain-immunoglobulin-like molecule with tyrosine-based activation motifs; MYD-1; CD172A; PTPNS1
• Gene ID: 140885
• mRNA Refseq: NM_001040022
• Protein Refseq: NP_001035111
• MIM: 602461
• UniProt ID: P78324