Recombinant Human SI

Description :	This gene encodes a sucrase-isomaltase enzyme that is expressed in the intestinal brush border. The encoded protein is synthesized as a precursor protein that is cleaved by pancreatic proteases into two enzymatic subunits sucrase and isomaltase. These two subunits heterodimerize to form the sucrose-isomaltase complex. This complex is essential for the digestion of dietary carbohydrates including starch, sucrose and isomaltose. Mutations in this gene are the cause of congenital sucrase-isomaltase deficiency.
Protein length :	99 amino acids
Molecular Weight :	36.520kDa inclusive of tags
Source :	Wheat germ
Tissue specificity :	Expressed in the poorly differentiated crypt cells of the small intestine as well as in the mature villous cells. Expressed at very low levels in the colon.
Form :	Liquid
Purity :	Proprietary Purification
Storage buffer :	pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage :	Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids :	DGESIDTYERDLYLSVQFNLNQTTLTSTILKRGYINKSETRLGSLHVWGKGTTPVNAVTLTYNGNKNSLPFNEDTTNMILRIDLTTHNVTLEEPIEINW
Sequence Similarities :	Belongs to the glycosyl hydrolase 31 family.Contains 2 P-type (trefoil) domains.
Tag :	Non

Gene Name	SI sucrase-isomaltase (alpha-glucosidase) [ Homo sapiens ]
Official Symbol	SI
Synonyms	SI; sucrase-isomaltase (alpha-glucosidase); sucrase isomaltase; sucrase-isomaltase, intestinal; Oligosaccharide alpha 1; 6 glucosidase;
Gene ID	6476
mRNA Refseq	NM_001041
Protein Refseq	NP_001032
MIM	609845
Uniprot ID	P14410
Chromosome Location	3q25.2-q26.2
Pathway	Carbohydrate digestion and absorption, organism-specific biosystem; Carbohydrate digestion and absorption, conserved biosystem; Digestion of dietary carbohydrate, organism-specific biosystem; Galactose metabolism, organism-specific biosystem; Galactose metabolism, conserved biosystem;
Function	alpha-glucosidase activity; carbohydrate binding; oligo-1,6-glucosidase activity; sucrose alpha-glucosidase activity;