Recombinant Human SH3RF2 protein, His-tagged

• Cat.No.: SH3RF2-3968H
• Product Overview: Recombinant Human SH3RF2 protein(75-295 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 75-295 aa
• AA Sequence: MRKSKWWQRDGSLQRPLQSGIPTLVVGSLRRSPTMVLRPQQFQFYQPQGIPSSPSAVVVEMGSKPALTGEPALTCISRGSEARIHSAASSLIMEDKEIPIKSEPLPKPPASAPPSILVKPENSRNGIEKQVKTVRFQNYSPPPTKHYTSHPTSGKPEQPATLKASQPEAASLGPEMTVLFAHRSGCHSGQQTDLRRKSALAKATTLVSTASGTQTVFPSK
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: SH3RF2 SH3 domain containing ring finger 2 [ Homo sapiens ]
• Official Symbol: SH3RF2
• Synonyms: SH3RF2; SH3 domain containing ring finger 2; PPP1R39, protein phosphatase 1, regulatory subunit 39; putative E3 ubiquitin-protein ligase SH3RF2; FLJ23654; heart protein phosphatase 1 binding protein; Hepp1; POSH eliminating RING protein; POSHER; RNF158; RING finger protein 158; POSH-eliminating RING protein; SH3 domain-containing RING finger protein 2; heart protein phosphatase 1-binding protein; protein phosphatase 1 regulatory subunit 39; protein phosphatase 1, regulatory subunit 39; HEPP1; PPP1R39; MGC90410; MGC149788; MGC149789
• Gene ID: 153769
• mRNA Refseq: NM_152550
• Protein Refseq: NP_689763
• MIM: 613377
• UniProt ID: Q8TEC5