Recombinant Human SH3D19 protein, GST-tagged

Source :	E. coli
Species :	Human
Tag :	GST
Form :	The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
Protein length :	415-764 aa
AA Sequence :	VLVMLKQTENNYLECQKGEDTGRVHLSQMKIITPLDEHLRSRPNDPSHAQKPVDSGAPHAVVLHDFPAEQVDDLNLTSGEIVYLLEKIDTDWYRGNCRNQIGIFPANYVKVIIDIPEGGNGKRECVSSHCVKGSRCVARFEYIGEQKDELSFSEGEIIILKEYVNEEWARGEVRGRTGIFPLNFVEPVEDYPTSGANVLSTKVPLKTKKEDSGSNSQVNSLPAEWCEALHSFTAETSDDLSFKRGDRIQILERLDSDWCRGRLQDREGIFPAVFVRPCPAEAKSMLAIVPKGRKAKALYDFRGENEDELSFKAGDIITELESVDDDWMSGELMGKSGIFPKNYIQFLQIS
Purity :	85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage :	Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution :	Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).

Gene Name	SH3D19 SH3 domain containing 19 [ Homo sapiens ]
Official Symbol	SH3D19
Synonyms	SH3D19; SH3 domain containing 19; SH3 domain-containing protein 19; DKFZp434D0215; EBP; EEN binding protein; EVE1; Kryn; SH3P19; EEN-binding protein; SH3 domain protein D19; ADAM-binding protein Eve-1; MGC105136; MGC118910; MGC118911; MGC118912; MGC118913;
Gene ID	152503
mRNA Refseq	NM_001009555
Protein Refseq	NP_001009555
MIM	608674
UniProt ID	Q5HYK7