Recombinant Human SH3BGRL2 protein, GST-tagged

• Cat.No.: SH3BGRL2-30170H
• Product Overview: Recombinant Human SH3BGRL2 (1-107 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Met1-Pro107
• AA Sequence: MVIRVFIASSSGFVAIKKKQQDVVRFLEANKIEFEEVDTTMSEEQRQWMYKNVPPEKKPTQGNPLPPQIFNGDRYCGDYDSFFESKESNTVFSFLGLKPRLASKAEP
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: SH3BGRL2 SH3 domain binding glutamic acid-rich protein like 2 [ Homo sapiens ]
• Official Symbol: SH3BGRL2
• Synonyms: SH3BGRL2; SH3 domain binding glutamic acid-rich protein like 2; SH3 domain-binding glutamic acid-rich-like protein 2; fovea-associated SH3 domain-binding protein; FASH3
• Gene ID: 83699
• mRNA Refseq: NM_031469
• Protein Refseq: NP_113657
• UniProt ID: Q9UJC5