Recombinant Human SH3BGRL

• Cat.No.: SH3BGRL-30811TH
• Product Overview: Recombinant full length Human SH3BGRL with N-terminal proprietary tag. Predicted MW 38.65kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 114 amino acids
• Description: SH3 domain-binding glutamic acid-rich-like protein is a protein that in humans is encoded by the SH3BGRL gene.
• Molecular Weight: 38.650kDa inclusive of tags
• Tissue specificity: Ubiquitous.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MVIRVYIASSSGSTAIKKKQQDVLGFLEANKIGFEEKDIA ANEENRKWMRENVPENSRPATGYPLPPQIFNESQYRGDYD AFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA
• Sequence Similarities: Belongs to the SH3BGR family.

Gene Information

• Gene Name: SH3BGRL SH3 domain binding glutamic acid-rich protein like [ Homo sapiens ]
• Official Symbol: SH3BGRL
• Synonyms: SH3BGRL; SH3 domain binding glutamic acid-rich protein like; SH3 domain-binding glutamic acid-rich-like protein; MGC117402
• Gene ID: 6451
• mRNA Refseq: NM_003022
• Protein Refseq: NP_003013
• MIM: 300190
• Uniprot ID: O75368
• Chromosome Location: Xq13.3
• Pathway: EGFR1 Signaling Pathway, organism-specific biosystem
• Function: SH3 domain binding; SH3/SH2 adaptor activity