Recombinant Human SH2D4A Protein, GST-tagged

• Cat.No.: SH2D4A-85H
• Product Overview: Human SH2D4A partial ORF ( AAH14525, 239 a.a. - 338 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Ubiquitous expression in ovary (RPKM 11.6), stomach (RPKM 9.2) and 22 other tissues.
• Molecular Mass: 36.63 kDa
• AA Sequence: KKANELLLSTGMPGSFLIRVSERIKGYALSYLSEDGCKHFLIDASADAYSFLGVDQLQHATLADLVEYHKEEPITSLGKELLLYPCGQQDQLPDYLELFE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SH2D4A SH2 domain containing 4A [ Homo sapiens (human) ]
• Official Symbol: SH2D4A
• Synonyms: SH2D4A; SH2 domain containing 4A; SH2A; PPP1R38; SH2 domain-containing protein 4A; protein SH(2)A; protein phosphatase 1 regulatory subunit 38
• Gene ID: 63898
• mRNA Refseq: NM_022071
• Protein Refseq: NP_071354
• MIM: 614968
• UniProt ID: Q9H788