Recombinant Human SH2D1A Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SH2D1A-3239H
• Product Overview: SH2D1A MS Standard C13 and N15-labeled recombinant protein (NP_002342) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a protein that plays a major role in the bidirectional stimulation of T and B cells. This protein contains an SH2 domain and a short tail. It associates with the signaling lymphocyte-activation molecule, thereby acting as an inhibitor of this transmembrane protein by blocking the recruitment of the SH2-domain-containing signal-transduction molecule SHP-2 to its docking site. This protein can also bind to other related surface molecules that are expressed on activated T, B and NK cells, thereby modifying signal transduction pathways in these cells. Mutations in this gene cause lymphoproliferative syndrome X-linked type 1 or Duncan disease, a rare immunodeficiency characterized by extreme susceptibility to infection with Epstein-Barr virus, with symptoms including severe mononucleosis and malignant lymphoma. Multiple transcript variants encoding different isoforms have been found for this gene.
• Molecular Mass: 14.2 kDa
• AA Sequence: MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SH2D1A SH2 domain containing 1A [ Homo sapiens (human) ]
• Official Symbol: SH2D1A
• Synonyms: SH2D1A; SH2 domain containing 1A; IMD5, lymphoproliferative syndrome, LYP, SH2 domain protein 1A; SH2 domain-containing protein 1A; DSHP; Duncans disease; EBVS; MTCP1; SAP; XLP; XLPD; SLAM-associated protein; Duncan disease SH2-protein; T cell signal transduction molecule SAP; T-cell signal transduction molecule SAP; SLAM associated protein/SH2 domain protein 1A; signaling lymphocyte activation molecule-associated protein; signaling lymphocytic activation molecule-associated protein; LYP; IMD5; SAP/SH2D1A; FLJ18687; FLJ92177
• Gene ID: 4068
• mRNA Refseq: NM_002351
• Protein Refseq: NP_002342
• MIM: 300490
• UniProt ID: O60880