Recombinant Human SH2D1A protein, GST-tagged

• Cat.No.: SH2D1A-2639H
• Product Overview: Recombinant Human SH2D1A protein(1-128 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: GST
• Protein Length: 1-128 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: SH2D1A
• Synonyms: SH2D1A; SH2 domain containing 1A; IMD5, lymphoproliferative syndrome , LYP, SH2 domain protein 1A; SH2 domain-containing protein 1A; DSHP; Duncans disease; EBVS; MTCP1; SAP; XLP; XLPD; SLAM-associated protein; Duncan disease SH2-protein; T cell signal transduction molecule SAP; T-cell signal transduction molecule SAP; SLAM associated protein/SH2 domain protein 1A; signaling lymphocyte activation molecule-associated protein; signaling lymphocytic activation molecule-associated protein; LYP; IMD5; SAP/SH2D1A; FLJ18687; FLJ92177
• Gene ID: 4068
• mRNA Refseq: NM_001114937
• Protein Refseq: NP_001108409
• MIM: 300490
• UniProt ID: O60880