Recombinant Human SGMS1 Full Length Transmembrane protein, His-tagged
Cat.No. : | SGMS1-1318H |
Product Overview : | Recombinant Human SGMS1 protein(Q86VZ5)(1-413aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-419aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 51.4 kDa |
AA Sequence : | MLSASTMKEVVYWSPKKVADWLLENAMPEYCEPLEHFTGQDLINLTQEDFKKPPLCRVSS DNGQRLLDMIETLKMEHHLEAHKNGHANGHLNIGVDIPTPDGSFSIKIKPNGMPNGYRKE MIKIPMPELERSQYPMEWGKTFLAFLYALSCFVLTTVMISVVHERVPPKEVQPPLPDTFF DHFNRVQWAFSICEINGMILVGLWLIQWLLLKYKSIISRRFFCIVGTLYLYRCITMYVTT LPVPGMHFNCSPKLFGDWEAQLRRIMKLIAGGGLSITGSHNMCGDYLYSGHTVMLTLTYL FIKEYSPRRLWWYHWICWLLSVVGIFCILLAHDHYTVDVVVAYYITTRLFWWYHTMANQQ VLKEASQMNLLARVWWYRPFQYFEKNVQGIVPRSYHWPFPWPVVHLSRQVKYSRLVNDT |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
SGMS1-4182R | Recombinant Rhesus monkey SGMS1 Protein, His-tagged | +Inquiry |
RFL24468HF | Recombinant Full Length Human Phosphatidylcholine:Ceramide Cholinephosphotransferase 1(Sgms1) Protein, His-Tagged | +Inquiry |
SGMS1-1292H | Recombinant Human SGMS1 Protein, Strep II-tagged | +Inquiry |
SGMS1-5366R | Recombinant Rat SGMS1 Protein | +Inquiry |
SGMS1-1318H | Recombinant Human SGMS1 Full Length Transmembrane protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SGMS1-592HCL | Recombinant Human SGMS1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SGMS1 Products
Required fields are marked with *
My Review for All SGMS1 Products
Required fields are marked with *
0
Inquiry Basket