Recombinant Human SGK494 Protein, GST-tagged
Cat.No. : | SGK494-4291H |
Product Overview : | Human FLJ25006 full-length ORF ( NP_653211.1, 1 a.a. - 274 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | SGK494 (Uncharacterized Serine/Threonine-Protein Kinase SgK494) is a Protein Coding gene. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is RPS6KA2. |
Molecular Mass : | 57.4 kDa |
AA Sequence : | MGAVSCRQGQHTQQGEHTRVAVPHKQGGNIRGPWARGWKSLWTGLGTIRSDLEELWELRGHHYLHQESLKPAPVLVEKPLPEWPVPQFINLFLPEFPIRPIRGQQQLKILGLVAKGSFGTVLKVLDCTQKAVFAVKVVPKVKVLQRDTVRQCKEEVSIQRQINHPFVHSLGDSWQGKRHLFIMCSYCSTDLYSLWSAVGCFPEASIRLFAAELVLVLCYLHDLGIMHRDVKMENILLDERGHLKLTDFGLSRHVPQGAQAYTICGTLQYMGERG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | SGK494 uncharacterized serine/threonine-protein kinase SgK494 [ Homo sapiens (human) ] |
Official Symbol | SGK494 |
Synonyms | SGK494; uncharacterized serine/threonine-protein kinase SgK494; uncharacterized serine/threonine-protein kinase SgK494; sugen kinase 494; EC 2.7.11.1 |
Gene ID | 124923 |
mRNA Refseq | NM_001174103 |
Protein Refseq | NP_001167574 |
◆ Recombinant Proteins | ||
SGK494-4972HF | Recombinant Full Length Human SGK494 Protein, GST-tagged | +Inquiry |
SGK494-4291H | Recombinant Human SGK494 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SGK494 Products
Required fields are marked with *
My Review for All SGK494 Products
Required fields are marked with *
0
Inquiry Basket