Recombinant Human SGK494 Protein, GST-tagged

• Cat.No.: SGK494-4291H
• Product Overview: Human FLJ25006 full-length ORF ( NP_653211.1, 1 a.a. - 274 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: SGK494 (Uncharacterized Serine/Threonine-Protein Kinase SgK494) is a Protein Coding gene. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is RPS6KA2.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 57.4 kDa
• AA Sequence: MGAVSCRQGQHTQQGEHTRVAVPHKQGGNIRGPWARGWKSLWTGLGTIRSDLEELWELRGHHYLHQESLKPAPVLVEKPLPEWPVPQFINLFLPEFPIRPIRGQQQLKILGLVAKGSFGTVLKVLDCTQKAVFAVKVVPKVKVLQRDTVRQCKEEVSIQRQINHPFVHSLGDSWQGKRHLFIMCSYCSTDLYSLWSAVGCFPEASIRLFAAELVLVLCYLHDLGIMHRDVKMENILLDERGHLKLTDFGLSRHVPQGAQAYTICGTLQYMGERG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SGK494 uncharacterized serine/threonine-protein kinase SgK494 [ Homo sapiens (human) ]
• Official Symbol: SGK494
• Synonyms: SGK494; uncharacterized serine/threonine-protein kinase SgK494; uncharacterized serine/threonine-protein kinase SgK494; sugen kinase 494; EC 2.7.11.1
• Gene ID: 124923
• mRNA Refseq: NM_001174103
• Protein Refseq: NP_001167574