Recombinant Human SGK494 Protein, GST-tagged

Cat.No. : SGK494-4291H
Product Overview : Human FLJ25006 full-length ORF ( NP_653211.1, 1 a.a. - 274 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : SGK494 (Uncharacterized Serine/Threonine-Protein Kinase SgK494) is a Protein Coding gene. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is RPS6KA2.
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 57.4 kDa
AA Sequence : MGAVSCRQGQHTQQGEHTRVAVPHKQGGNIRGPWARGWKSLWTGLGTIRSDLEELWELRGHHYLHQESLKPAPVLVEKPLPEWPVPQFINLFLPEFPIRPIRGQQQLKILGLVAKGSFGTVLKVLDCTQKAVFAVKVVPKVKVLQRDTVRQCKEEVSIQRQINHPFVHSLGDSWQGKRHLFIMCSYCSTDLYSLWSAVGCFPEASIRLFAAELVLVLCYLHDLGIMHRDVKMENILLDERGHLKLTDFGLSRHVPQGAQAYTICGTLQYMGERG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SGK494 uncharacterized serine/threonine-protein kinase SgK494 [ Homo sapiens (human) ]
Official Symbol SGK494
Synonyms SGK494; uncharacterized serine/threonine-protein kinase SgK494; uncharacterized serine/threonine-protein kinase SgK494; sugen kinase 494; EC 2.7.11.1
Gene ID 124923
mRNA Refseq NM_001174103
Protein Refseq NP_001167574

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SGK494 Products

Required fields are marked with *

My Review for All SGK494 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon