Recombinant Human SGCG

• Cat.No.: SGCG-26403TH
• Product Overview: Recombinant fragment corresponding to amino acids 191-290 of Human gamma Sarcoglycan with an N terminal proprietary tag; Predicted MWt 36.63 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: This gene encodes gamma-sarcoglycan, one of several sarcolemmal transmembrane glycoproteins that interact with dystrophin. The dystrophin-glycoprotein complex (DGC) spans the sarcolemma and is comprised of dystrophin, syntrophin, alpha- and beta-dystroglycans and sarcoglycans. The DGC provides a structural link between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells. Defects in the encoded protein can lead to early onset autosomal recessive muscular dystrophy, in particular limb-girdle muscular dystrophy, type 2C (LGMD2C).
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Expressed in skeletal and heart muscle.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: DLRLESPTRSLSMDAPRGVHIQAHAGKIEALSQMDILFHSSDGMLVLDAETVCLPKLVQGTWGPSGSSQSLYEICVCPDGKLYLSVAGVSTTCQEHSHIC
• Sequence Similarities: Belongs to the sarcoglycan beta/delta/gamma/zeta family.

Gene Information

• Gene Name: SGCG sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein) [ Homo sapiens ]
• Official Symbol: SGCG
• Synonyms: SGCG; sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein); DMDA1, LGMD2C, MAM, sarcoglycan, gamma (35kD dystrophin associated glycoprotein); gamma-sarcoglycan; 35kD dystrophin associated glycoprotein; A4; DAGA4; DMDA; gamma sarcoglycan; limb gi
• Gene ID: 6445
• mRNA Refseq: NM_000231
• Protein Refseq: NP_000222
• MIM: 608896
• Uniprot ID: Q13326
• Chromosome Location: 13q12-q13
• Pathway: Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; Dilated cardiomyopathy, organism-specific biosystem; Dilated cardiomyopathy, conserved biosystem; Hypertrophic cardiomyopathy (HCM), organism-specific biosystem