Recombinant Human SFRS11 protein, GST-tagged

• Cat.No.: SFRS11-301358H
• Product Overview: Recombinant Human SFRS11 (398-483 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: Lys398-Asp483
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: KKKSKDKEKDRERKSESDKDVKVTRDYDEEEQGYDSEKEKKEEKKPIETGSPKTKECSVEKGTGDSLRESKVNGDDHHEEDMDMSD
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: SRSF11 serine and arginine rich splicing factor 11 [ Homo sapiens (human) ]
• Official Symbol: SFRS11
• Synonyms: p54; NET2; SRSF11; dJ677H15.2
• Gene ID: 9295
• mRNA Refseq: NM_001190987
• Protein Refseq: NP_001177916
• MIM: 602010
• UniProt ID: Q05519