Recombinant Human SFRP4

• Cat.No.: SFRP4-30079TH
• Product Overview: Recombinant fragment of Human SFRP4 with N terminal proprietary tag, 36.85kDa inclusive of tag.

Specification

• Description: Secreted frizzled-related protein 4 (SFRP4) is a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. The expression of SFRP4 in ventricular myocardium correlates with apoptosis related gene expression.
• Protein length: 102 amino acids
• Molecular Weight: 36.850kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Expressed in mesenchymal cells. Highly expressed in the stroma of proliferative endometrium. Expressed in cardiomyocytes. Shows moderate to strong expression in ovarian tumors with expression increasing as the tumor stage increases. In ovarian tumors, exp
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: CNEVTTVVDVKEIFKSSSPIPRTQVPLITNSSCQCPHILP HQDVLIMCYEWRSRMMLLENCLVEKWRDQLSKRSIQWEER LQEQRRTVQDKKKTAGRTSRSN
• Sequence Similarities: Belongs to the secreted frizzled-related protein (sFRP) family.Contains 1 FZ (frizzled) domain.Contains 1 NTR domain.
• Tag: Non

Gene Information

• Gene Name: SFRP4 secreted frizzled-related protein 4 [ Homo sapiens ]
• Official Symbol: SFRP4
• Synonyms: SFRP4; secreted frizzled-related protein 4; FRP 4; FRPHE; frpHE
• Gene ID: 6424
• mRNA Refseq: NM_003014
• Protein Refseq: NP_003005
• MIM: 606570
• Uniprot ID: Q6FHJ7
• Chromosome Location: 7p14.1
• Pathway: Adipogenesis, organism-specific biosystem; Wnt Signaling Pathway, organism-specific biosystem; Wnt signaling pathway, organism-specific biosystem; Wnt signaling pathway, conserved biosystem
• Function: PDZ domain binding; Wnt-activated receptor activity; Wnt-protein binding