Recombinant Human SFRP2 protein(68-186aa), His-GST-tagged
Cat.No. : | SFRP2-422H |
Product Overview : | Recombinant Human SFRP2 protein(Q96HF1)(68-186aa), fused with N-terminal His and GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His |
Protein Length : | 68-186aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 44.9 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | TMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIM |
Gene Name | SFRP2 secreted frizzled-related protein 2 [ Homo sapiens ] |
Official Symbol | SFRP2 |
Synonyms | SFRP2; secreted frizzled-related protein 2; FRP 2; SARP1; SDF 5; SARP-1; sFRP-2; secreted apoptosis related protein 1; secreted apoptosis-related protein 1; FRP-2; SDF-5; |
Gene ID | 6423 |
mRNA Refseq | NM_003013 |
Protein Refseq | NP_003004 |
MIM | 604157 |
UniProt ID | Q96HF1 |
◆ Recombinant Proteins | ||
SFRP2-5110H | Recombinant Human SFRP2, His-tagged | +Inquiry |
SFRP2-6337C | Recombinant Chicken SFRP2 | +Inquiry |
SFRP2-299H | Active Recombinant Human SFRP2 | +Inquiry |
Sfrp2-008M | Recombinant Mouse Sfrp2 Protein, His-tagged | +Inquiry |
SFRP2-7655H | Recombinant Human SFRP2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SFRP2-2851MCL | Recombinant Mouse SFRP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SFRP2 Products
Required fields are marked with *
My Review for All SFRP2 Products
Required fields are marked with *
0
Inquiry Basket