Recombinant Human SFRP2 protein(68-186aa), His-GST-tagged

• Cat.No.: SFRP2-422H
• Product Overview: Recombinant Human SFRP2 protein(Q96HF1)(68-186aa), fused with N-terminal His and GST tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: N-His-GST
• Protein length: 68-186aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 44.9 kDa
• AASequence: TMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIM
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: SFRP2 secreted frizzled-related protein 2 [ Homo sapiens ]
• Official Symbol: SFRP2
• Synonyms: SFRP2; secreted frizzled-related protein 2; FRP 2; SARP1; SDF 5; SARP-1; sFRP-2; secreted apoptosis related protein 1; secreted apoptosis-related protein 1; FRP-2; SDF-5
• Gene ID: 6423
• mRNA Refseq: NM_003013
• Protein Refseq: NP_003004
• MIM: 604157
• UniProt ID: Q96HF1