Recombinant Human SETD7, GST-tagged
Cat.No. : | SETD7-29235TH |
Product Overview : | Recombinant fragment: FFFDGSTLEG YYVDDALQGQ GVYTYEDGGV LQGTYVDGEL NGPAQEYDTD GRLIFKGQYK DNIRHGVCWI YYPDGGSLVG EVNEDGEMTG EKIAYV, corresponding to amino acids 52-147 of Human KMT7 / SETD7/ SET7/9, with N-terminal proprietary tag, 61 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 52-147 a.a. |
Description : | Histone-lysine N-methyltransferase SETD7 is an enzyme that in humans is encoded by the SETD7 gene. |
Conjugation : | GST |
Tissue specificity : | Widely expressed. Expressed in pancreatic islets. |
Biological activity : | Specific Activity: 140 pmol/min/mg.Assay conditions: 50 μl reaction mix (50 mMTRIS pH8.8, 5 mM MgCl2, 4 mM DTT, 20 μMS-adenosylhomocysteine, and 0-10 ng SET7/9)add to the wells coated with the substrate.Incubate for 1 hr. Add antibody againstmethylated K4 |
Form : | Liquid |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.05% Tween 20, 3mM DTT, 25mM Tris HCl, 100mM Sodium chloride, pH 8 |
Storage : | Aliquot and store at -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | FFFDGSTLEGYYVDDALQGQGVYTYEDGGVLQGTYVDGELNGPAQEYDTDGRLIFKGQYKDNIRHGVCWIYYPDGGSLVGEVNEDGEMTGEKIAYV |
Sequence Similarities : | Belongs to the histone-lysine methyltransferase family. SET7 subfamily.Contains 3 MORN repeats.Contains 1 SET domain. |
Gene Name | SETD7 SET domain containing (lysine methyltransferase) 7 [ Homo sapiens ] |
Official Symbol | SETD7 |
Synonyms | SETD7; SET domain containing (lysine methyltransferase) 7; histone-lysine N-methyltransferase SETD7; KIAA1717; KMT7; SET7; SET7/9; Set9; |
Gene ID | 80854 |
mRNA Refseq | NM_030648 |
Protein Refseq | NP_085151 |
MIM | 606594 |
Uniprot ID | Q8WTS6 |
Chromosome Location | 4q31.1 |
Pathway | Lysine degradation, organism-specific biosystem; Lysine degradation, conserved biosystem; p53 pathway, organism-specific biosystem; |
Function | histone-lysine N-methyltransferase activity; histone-lysine N-methyltransferase activity; methyltransferase activity; p53 binding; protein binding; |
◆ Recombinant Proteins | ||
SETD7-4166R | Recombinant Rhesus monkey SETD7 Protein, His-tagged | +Inquiry |
SETD7-4683H | Recombinant Human SETD7 protein, His-SUMO & Myc-tagged | +Inquiry |
SETD7-3983R | Recombinant Rhesus Macaque SETD7 Protein, His (Fc)-Avi-tagged | +Inquiry |
SETD7-185H | Active Recombinant Human SETD7, GST-tagged | +Inquiry |
SETD7-22H | Recombinant Human SETD7 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SETD7-1925HCL | Recombinant Human SETD7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SETD7 Products
Required fields are marked with *
My Review for All SETD7 Products
Required fields are marked with *
0
Inquiry Basket