Recombinant Human SETD7, GST-tagged

• Cat.No.: SETD7-29235TH
• Product Overview: Recombinant fragment: FFFDGSTLEG YYVDDALQGQ GVYTYEDGGV LQGTYVDGEL NGPAQEYDTD GRLIFKGQYK DNIRHGVCWI YYPDGGSLVG EVNEDGEMTG EKIAYV, corresponding to amino acids 52-147 of Human KMT7 / SETD7/ SET7/9, with N-terminal proprietary tag, 61 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 52-147 a.a.
• Description: Histone-lysine N-methyltransferase SETD7 is an enzyme that in humans is encoded by the SETD7 gene.
• Conjugation: GST
• Tissue specificity: Widely expressed. Expressed in pancreatic islets.
• Biological activity: Specific Activity: 140 pmol/min/mg.Assay conditions: 50 μl reaction mix (50 mMTRIS pH8.8, 5 mM MgCl2, 4 mM DTT, 20 μMS-adenosylhomocysteine, and 0-10 ng SET7/9)add to the wells coated with the substrate.Incubate for 1 hr. Add antibody againstmethylated K4
• Form: Liquid
• Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.05% Tween 20, 3mM DTT, 25mM Tris HCl, 100mM Sodium chloride, pH 8
• Storage: Aliquot and store at -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: FFFDGSTLEGYYVDDALQGQGVYTYEDGGVLQGTYVDGELNGPAQEYDTDGRLIFKGQYKDNIRHGVCWIYYPDGGSLVGEVNEDGEMTGEKIAYV
• Sequence Similarities: Belongs to the histone-lysine methyltransferase family. SET7 subfamily.Contains 3 MORN repeats.Contains 1 SET domain.

Gene Information

• Gene Name: SETD7 SET domain containing (lysine methyltransferase) 7 [ Homo sapiens ]
• Official Symbol: SETD7
• Synonyms: SETD7; SET domain containing (lysine methyltransferase) 7; histone-lysine N-methyltransferase SETD7; KIAA1717; KMT7; SET7; SET7/9; Set9
• Gene ID: 80854
• mRNA Refseq: NM_030648
• Protein Refseq: NP_085151
• MIM: 606594
• Uniprot ID: Q8WTS6
• Chromosome Location: 4q31.1
• Pathway: Lysine degradation, organism-specific biosystem; Lysine degradation, conserved biosystem; p53 pathway, organism-specific biosystem
• Function: histone-lysine N-methyltransferase activity; histone-lysine N-methyltransferase activity; methyltransferase activity; p53 binding; protein binding