Recombinant Human SERPINB6 protein(141-330 aa), C-His-tagged
Cat.No. : | SERPINB6-2734H |
Product Overview : | Recombinant Human SERPINB6 protein(P35237)(141-330 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 141-330 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | KTEGKIAELLSPGSVDPLTRLVLVNAVYFRGNWDEQFDKENTEERLFKVSKNEEKPVQMMFKQSTFKKTYIGEIFTQILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRLDMMDEEEVEVSLPRFKLEESYDMESVLRNLGMTDAFELGKADFSGMSQTDLSLSKVVHKSFVEVNEEGTEA |
Gene Name | SERPINB6 serpin peptidase inhibitor, clade B (ovalbumin), member 6 [ Homo sapiens ] |
Official Symbol | SERPINB6 |
Synonyms | SERPINB6; serpin peptidase inhibitor, clade B (ovalbumin), member 6; deafness, autosomal recessive 91 , DFNB91, PI6, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 6; serpin B6; CAP; cytoplasmic antiproteinase; PTI; PI-6; protease inhibitor 6 (placental thrombin inhibitor); serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 6; PI6; SPI3; DFNB91; MSTP057; MGC111370; DKFZp686I04222; |
Gene ID | 5269 |
mRNA Refseq | NM_001195291 |
Protein Refseq | NP_001182220 |
MIM | 173321 |
UniProt ID | P35237 |
◆ Recombinant Proteins | ||
SERPINB6-1071H | Recombinant Human SERPINB6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SERPINB6-7781H | Recombinant Human SERPINB6, His-tagged | +Inquiry |
SERPINB6-912C | Recombinant Cynomolgus SERPINB6 Protein, His-tagged | +Inquiry |
SERPINB6-2595H | Recombinant Human SERPINB6, His-tagged | +Inquiry |
SERPINB6-5915H | Recombinant Human SERPINB6 Protein (Met1-Pro376), N-His and Trx tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERPINB6-553HCL | Recombinant Human SERPINB6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SERPINB6 Products
Required fields are marked with *
My Review for All SERPINB6 Products
Required fields are marked with *
0
Inquiry Basket