Recombinant Human SERPINB6 protein(141-330 aa), C-His-tagged

• Cat.No.: SERPINB6-2734H
• Product Overview: Recombinant Human SERPINB6 protein(P35237)(141-330 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 141-330 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: KTEGKIAELLSPGSVDPLTRLVLVNAVYFRGNWDEQFDKENTEERLFKVSKNEEKPVQMMFKQSTFKKTYIGEIFTQILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRLDMMDEEEVEVSLPRFKLEESYDMESVLRNLGMTDAFELGKADFSGMSQTDLSLSKVVHKSFVEVNEEGTEA

Gene Information

• Gene Name: SERPINB6 serpin peptidase inhibitor, clade B (ovalbumin), member 6 [ Homo sapiens ]
• Official Symbol: SERPINB6
• Synonyms: SERPINB6; serpin peptidase inhibitor, clade B (ovalbumin), member 6; deafness, autosomal recessive 91 , DFNB91, PI6, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 6; serpin B6; CAP; cytoplasmic antiproteinase; PTI; PI-6; protease inhibitor 6 (placental thrombin inhibitor); serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 6; PI6; SPI3; DFNB91; MSTP057; MGC111370; DKFZp686I04222
• Gene ID: 5269
• mRNA Refseq: NM_001195291
• Protein Refseq: NP_001182220
• MIM: 173321
• UniProt ID: P35237