Recombinant Human SERPINB1
Cat.No. : | SERPINB1-31161TH |
Product Overview : | Recombinant fragment corresponding to amino acids 201-300 of Human SERPINB1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | Leukocyte elastase inhibitor (LEI) also known as serpin B1 is a protein that in humans is encoded by the SERPINB1 gene. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KKKFAYGYIEDLKCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENLDFIEVNVSLPRFKLEESYTLNSDLARLGVQDLFNSS |
Sequence Similarities : | Belongs to the serpin family. Ov-serpin subfamily. |
Gene Name | SERPINB1 serpin peptidase inhibitor, clade B (ovalbumin), member 1 [ Homo sapiens ] |
Official Symbol | SERPINB1 |
Synonyms | SERPINB1; serpin peptidase inhibitor, clade B (ovalbumin), member 1; ELANH2, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 1; leukocyte elastase inhibitor; anti elastase; EI; PI2; |
Gene ID | 1992 |
mRNA Refseq | NM_030666 |
Protein Refseq | NP_109591 |
MIM | 130135 |
Uniprot ID | P30740 |
Chromosome Location | 6p25 |
Pathway | Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; |
Function | peptidase inhibitor activity; serine-type endopeptidase inhibitor activity; serine-type endopeptidase inhibitor activity; |
◆ Recombinant Proteins | ||
SERPINB1-4149R | Recombinant Rhesus monkey SERPINB1 Protein, His-tagged | +Inquiry |
SERPINB1-3481P | Recombinant Pig SERPINB1 protein, His&Myc-tagged | +Inquiry |
SERPINB1-31161TH | Recombinant Human SERPINB1 | +Inquiry |
SERPINB1-3966R | Recombinant Rhesus Macaque SERPINB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SERPINB1-3480H | Recombinant Human SERPINB1 protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERPINB1-578HCL | Recombinant Human SERPINB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SERPINB1 Products
Required fields are marked with *
My Review for All SERPINB1 Products
Required fields are marked with *
0
Inquiry Basket