Recombinant Human SERF2 Protein, MYC/DDK-tagged, C13 and N15-labeled

• Cat.No.: SERF2-233H
• Product Overview: SERF2 MS Standard C13 and N15-labeled recombinant protein (NP_001018118) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Positive regulator of amyloid protein aggregation and proteotoxicity (PubMed:20723760). Induces conformational changes in amyloid proteins, such as HTT, driving them into compact formations preceding the formation of aggregates.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 6.9 kDa
• AA Sequence: MTRGNQRELARQKNMKKQSDSVKGKRRDDGLSAAARKQRDSEIMQQKQKKANEKKEEPKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SERF2 small EDRK-rich factor 2 [ Homo sapiens (human) ]
• Official Symbol: SERF2
• Synonyms: SERF2; small EDRK-rich factor 2; small EDRK-rich factor 2; gastric cancer-related protein VRG107; protein 4F5-related
• Gene ID: 10169
• mRNA Refseq: NM_001018108
• Protein Refseq: NP_001018118
• MIM: 605054
• UniProt ID: P84101