Recombinant Human SEPTIN14 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SEPTIN14-3774H
• Product Overview: SEPT14 MS Standard C13 and N15-labeled recombinant protein (NP_997249) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: SEPT14 is a member of the highly conserved septin family of GTP-binding cytoskeletal proteins implicated in membrane transport, apoptosis, cell polarity, cell cycle regulation, cytokinesis, and other cellular functions.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 49.8 kDa
• AA Sequence: MAERTMAMPTQIPADGDTQKENNIRCLTTIGHFGFECLPNQLVSRSIRQGFTFNILCVGETGIGKSTLIDTLFNTNLKDNKSSHFYSNVGLQIQTYELQESNVQLKLTVVETVGYGDQIDKEASYQPIVDYIDAQFEAYLQEELKIKRSLFEYHDSRVHVCLYFISPTGHSLKSLDLLTMKNLDSKVNIIPLIAKADTISKNDLQTFKNKIMSELISNGIQIYQLPTDEETAAQANSSVSGLLPFAVVGSTDEVKVGKRMVRGRHYPWGVLQVENENHCDFVKLRDMLLCTNMENLKEKTHTQHYECYRYQKLQKMGFTDVGPNNQPVSFQEIFEAKRQEFYDQCQREEEELKQRFMQRVKEKEATFKEAEKELQDKFEHLKMIQQEEIRKLEEEKKQLEGEIIDFYKMKAASEALQTQLSTDTKKDKHRKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SEPTIN14 septin 14 [ Homo sapiens (human) ]
• Official Symbol: SEPTIN14
• Synonyms: SEPTIN14; septin 14; SEPT14; septin-14
• Gene ID: 346288
• mRNA Refseq: NM_207366
• Protein Refseq: NP_997249
• MIM: 612140
• UniProt ID: Q6ZU15