Recombinant Human SENP8 protein, His-tagged

• Cat.No.: SENP8-3916H
• Product Overview: Recombinant Human SENP8 protein(1-212 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 1-212 aa
• AA Sequence: MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLIATLAKK
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: SENP8 SUMO/sentrin specific peptidase family member 8 [ Homo sapiens ]
• Official Symbol: SENP8
• Synonyms: SENP8; SUMO/sentrin specific peptidase family member 8; protease, cysteine, 2 (NEDD8 specific) , PRSC2, SUMO/sentrin specific protease family member 8; sentrin-specific protease 8; DEN1; deneddylase 1; HsT17512; NEDD8 specific protease 1; NEDP1; sentrin/SUMO specific protease SENP8; deneddylase-1; protease, cysteine 2; NEDD8-specific protease 1; NEDD8 specific-protease cysteine 2; SUMO sentrin specific protease family member 8; PRSC2
• Gene ID: 123228
• mRNA Refseq: NM_001166340
• Protein Refseq: NP_001159812
• MIM: 608659
• UniProt ID: Q96LD8