Recombinant Human SELPLG protein, T7/His-tagged

• Cat.No.: SELPLG-93H
• Product Overview: Recombinant human CD162 cDNA (18 – 320 aa, Isoform-II, derived from BC029782), fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 18-320 a.a.
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGTRLQLWDTWADEAEKALGPLLARDRRQATEYEYLDYDFLPETEPPEML RNSTDTTPLTGPGTPESTTVEPAARRSTGLDAGGAVTELTTELANMGNLSTDSAAMEIQTTQPAATEAQTTQPVP TEAQTTPLAATEAQTTRLTATEAQTTPLAATEAQTTPPAATEAQTTQPTGLEAQTTAPAAMEAQTTAPAAMEAQT TPPAAMEAQTTQTTAMEAQTTAPEATEAQTTQPTATEAQTTPLAAMEALSTEPSATEALSMEPTTKRGLFIPFSV SSVTHKGIPMAASNLSVNYPVGAPDHISVKQC
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro non-glycosylated CD162 protein mediated P-selectin related tumor metastasis regulation study with this protein as either coating matrix protein or soluble factor.2. May be used as CD162 protein-protein interaction assay.3. As enzymatic substrate for various proteases.4. As antigen for specific antibody production.
• Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.

Gene Information

• Gene Name: SELPLG selectin P ligand [ Homo sapiens ]
• Official Symbol: SELPLG
• Synonyms: SELPLG; selectin P ligand; P-selectin glycoprotein ligand 1; CD162; PSGL 1; cutaneous lymphocyte-associated associated antigen; CLA; PSGL1; PSGL-1
• Gene ID: 6404
• mRNA Refseq: NM_001206609
• Protein Refseq: NP_001193538
• MIM: 600738
• UniProt ID: Q14242
• Chromosome Location: 12q24
• Pathway: Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem; Staphylococcus aureus infection, organism-specific biosystem
• Function: bacterial cell surface binding; protein binding; receptor binding